SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432809 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432809
Domain Number 1 Region: 13-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000746
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432809   Gene: ENSG00000124440   Transcript: ENST00000533789
Sequence length 81
Comment pep:known chromosome:GRCh38:19:46297046:46309266:1 gene:ENSG00000124440 transcript:ENST00000533789 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCAAAGAHWTQHL
Download sequence
Identical sequences E9PNQ7
ENSP00000432809 ENSP00000432809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]