SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432823 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432823
Domain Number 1 Region: 22-78
Classification Level Classification E-value
Superfamily t-snare proteins 0.000000000235
Family t-snare proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432823   Gene: ENSG00000124222   Transcript: ENST00000483434
Sequence length 79
Comment pep:known chromosome:GRCh38:20:58651304:58676348:1 gene:ENSG00000124222 transcript:ENST00000483434 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLD
DSSEEEHAIEITTQEITQA
Download sequence
Identical sequences A0A2J8JC90 E9PND6
ENSP00000432823 ENSP00000437209 ENSP00000432823 ENSP00000437209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]