SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433509 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433509
Domain Number 1 Region: 85-123
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000842
Family FAD/NAD-linked reductases, N-terminal and central domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433509   Gene: ENSG00000133816   Transcript: ENST00000525119
Sequence length 134
Comment pep:known chromosome:GRCh38:11:12161446:12204387:1 gene:ENSG00000133816 transcript:ENST00000525119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDS
FSRNNVLHLWPFTI
Download sequence
Identical sequences A0A2J8P5F2 E9PKI3
ENSP00000433509 ENSP00000433509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]