SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000433935 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000433935
Domain Number 1 Region: 10-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.02e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000857
Further Details:      
 
Domain Number 2 Region: 367-479
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.25e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000433935   Gene: ENSG00000198431   Transcript: ENST00000527688
Sequence length 482
Comment pep:known chromosome:GRCh38:12:104288718:104350283:1 gene:ENSG00000198431 transcript:ENST00000527688 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVAL
REKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISS
DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
EEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKI
GLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAG
STVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNK
CYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEFFS
FI
Download sequence
Identical sequences E9PIR7
ENSP00000433935 ENSP00000433935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]