SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434099 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434099
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 4.32e-19
Family F-box domain 0.0039
Further Details:      
 
Domain Number 2 Region: 99-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000112
Family SMI1/KNR4-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434099   Gene: ENSG00000110429   Transcript: ENST00000532927
Sequence length 172
Comment pep:known chromosome:GRCh38:11:33747242:33774520:-1 gene:ENSG00000110429 transcript:ENST00000532927 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGTKWLEIQLLLTCLL
Download sequence
Identical sequences A0A2J8P3T3 A0A2J8WG38 B4E3U2
ENSP00000434099 ENSP00000434099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]