SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434303 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434303
Domain Number 1 Region: 8-87
Classification Level Classification E-value
Superfamily Caspase-like 4.19e-21
Family Caspase catalytic domain 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434303   Gene: ENSG00000137752   Transcript: ENST00000531166
Sequence length 88
Comment pep:known chromosome:GRCh38:11:105026225:105035113:-1 gene:ENSG00000137752 transcript:ENST00000531166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKVLKEKRKLFIRSMGEDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFS
FEQPDGRAQMPTTERVTLTRCFYLFPGH
Download sequence
Identical sequences A0A2I2ZX19 A0A2I3TRZ9
ENSP00000344132 ENSP00000434303 NP_150637.1.87134 NP_150637.1.92137 gi|15431334|ref|NP_150637.1| ENSP00000344132 ENSP00000408446 ENSP00000434303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]