SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434313 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434313
Domain Number 1 Region: 21-58
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 61-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434313   Gene: ENSG00000179241   Transcript: ENST00000524419
Sequence length 335
Comment pep:novel chromosome:GRCh38:11:35943981:36230267:1 gene:ENSG00000179241 transcript:ENST00000524419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLGPLCLLLSSAAAKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTAN
PLLCSTARYHCKNGLCIDKSFICDGQNNCQDNSDEESCESSQVSLLLPRLECSGTISAHC
KLRLPGSRHSPASASRVAGTTEPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALL
ALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNA
SEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSANSASSQAASS
LLSVEDTSHSPGQPGPQEGTAEPRDSEPSQGTEEV
Download sequence
Identical sequences A0A2I3TE65 E9PR86
ENSP00000434313 ENSP00000434313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]