SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434471 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434471
Domain Number 1 Region: 28-291
Classification Level Classification E-value
Superfamily Caspase-like 1.79e-82
Family Caspase catalytic domain 0.0000000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434471   Gene: ENSG00000137757   Transcript: ENST00000531367
Sequence length 292
Comment pep:known chromosome:GRCh38:11:104995744:105023136:-1 gene:ENSG00000137757 transcript:ENST00000531367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLQIEAGPPESAESTNILKLCPREEFLRLCKKNHDEIYPIKKREDRRRLALIICNTK
FDHLPARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDSTFL
VLMSHGILEGICGTAHKKKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHGE
LWVRDSPASLALISSQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITE
LITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIERATLTRDFYLFPGN
Download sequence
Identical sequences ENSP00000398130 ENSP00000434471 gi|209870073|ref|NP_001129582.1| ENSP00000398130 ENSP00000434471 NP_001129582.1.87134 NP_001129582.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]