SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000434594 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000434594
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.35e-30
Family Nucleotide and nucleoside kinases 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000434594   Gene: ENSG00000166548   Transcript: ENST00000525974
Sequence length 168
Comment pep:putative chromosome:GRCh38:16:66511713:66549825:-1 gene:ENSG00000166548 transcript:ENST00000525974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHDASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVD
YVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHE
EWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRILTPENRKHCP
Download sequence
Identical sequences ENSP00000433770 ENSP00000434594 ENSP00000463560 ENSP00000433770 ENSP00000434594 ENSP00000463560 NP_001258979.1.87134 NP_001258979.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]