SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435135 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435135
Domain Number 1 Region: 57-186
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.23e-27
Family Toll/Interleukin receptor TIR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435135   Gene: ENSG00000185187   Transcript: ENST00000528209
Sequence length 189
Comment pep:putative chromosome:GRCh38:11:406843:414957:-1 gene:ENSG00000185187 transcript:ENST00000528209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPSPAPSRTSASPPSLFRELALQATWLRCWPPSWSCWPCCWPPCSMSSAVSTCCSDGKL
YDAYVSYSDCPEDRKFVNFILKPQLERRRGYKLFLDDRDLLPRAEPSADLLVNLSRCRRL
IVVLSDAFLSRAWCSHSFREGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHRHLVT
LLLWRPGSV
Download sequence
Identical sequences E9PLG6
ENSP00000435135 ENSP00000435135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]