SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435163 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435163
Domain Number 1 Region: 52-100
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000159
Family Protein kinases, catalytic subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435163   Gene: ENSG00000079277   Transcript: ENST00000529170
Sequence length 101
Comment pep:known chromosome:GRCh38:1:46576584:46604255:-1 gene:ENSG00000079277 transcript:ENST00000529170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQC
Download sequence
Identical sequences E9PLE7
ENSP00000435163 ENSP00000435163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]