SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435536 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435536
Domain Number 1 Region: 2-221
Classification Level Classification E-value
Superfamily Caspase-like 6.58e-72
Family Caspase catalytic domain 0.00000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435536   Gene: ENSG00000137752   Transcript: ENST00000532439
Sequence length 236
Comment pep:novel chromosome:GRCh38:11:105025443:105030503:-1 gene:ENSG00000137752 transcript:ENST00000532439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDM
TTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCP
SLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFC
SSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKEVKRSFCKGFWNYVC
Download sequence
Identical sequences H0YEC7
ENSP00000435536 ENSP00000435536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]