SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435680 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435680
Domain Number 1 Region: 167-297
Classification Level Classification E-value
Superfamily ApaG-like 4.32e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 4-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.26e-18
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSP00000435680
Domain Number - Region: 306-338
Classification Level Classification E-value
Superfamily ARM repeat 0.00276
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435680   Gene: ENSG00000110429   Transcript: ENST00000526785
Sequence length 358
Comment pep:putative chromosome:GRCh38:11:33740939:33774347:-1 gene:ENSG00000110429 transcript:ENST00000526785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSED
LLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNP
AAIDMFIIGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFL
PELSSVHPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFP
IISPGRVYEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARL
EMGPDEYEEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences A0A2J8P3W4 A0A2J8WG09 G3V1E0
ENSP00000435680 ENSP00000435680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]