SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435813 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435813
Domain Number 1 Region: 279-524
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.89e-89
Family Eukaryotic proteases 0.0000347
Further Details:      
 
Domain Number 2 Region: 189-285
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-18
Family Hepsin, N-terminal domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSP00000435813
Domain Number - Region: 168-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000107
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435813   Gene: ENSG00000137747   Transcript: ENST00000528626
Sequence length 532
Comment pep:known chromosome:GRCh38:11:117900643:117929381:-1 gene:ENSG00000137747 transcript:ENST00000528626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDSHGNASPARTPSAGASPAQASPAGTPPGRASPAQASPAQASPAGTPPGRASPAQAS
PAGTPPGRASPGRASPAQASPAQASPARASPALASLSRSSSGRSSSARSASVTTSPTRVY
LVRATPVGAVPIRSSPARSAPATRATRESPVQFWQGHTGIRYKEQRESCPKHAVRCDGVV
DCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTT
EVAHRDFANSFSILRYNSTIQESLHRSECPSQRYISLQCSHCGLRAMTGRIVGGALASDS
KWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLHQLPEAA
SIAEIIINSNYTDEEDDYDIALMRLSKPLTLSAHIHPACLPMHGQTFSLNETCWITGFGK
TRETDDKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPL
VCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMESEVRFRKS
Download sequence
Identical sequences NP_001193718.1.87134 NP_001193718.1.92137 ENSP00000435813 gi|332205854|ref|NP_001193718.1| ENSP00000435813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]