SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000435894 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000435894
Domain Number 1 Region: 5-97
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.44e-30
Family Calpain large subunit, catalytic domain (domain II) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000435894   Gene: ENSG00000149260   Transcript: ENST00000527066
Sequence length 97
Comment pep:known chromosome:GRCh38:11:77066971:77093807:1 gene:ENSG00000149260 transcript:ENST00000527066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICED
PRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLW
Download sequence
Identical sequences E9PS73
ENSP00000435894 ENSP00000435894 ENSP00000460508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]