SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436073 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000436073
Domain Number - Region: 35-59
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0144
Family Integrin alpha N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436073   Gene: ENSG00000174483   Transcript: ENST00000533644
Sequence length 164
Comment pep:known chromosome:GRCh38:11:66510609:66523531:1 gene:ENSG00000174483 transcript:ENST00000533644 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLG
PGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRP
YFKFSLPQLPPNPLEQDLWNQAKEGDGRGAFVHPVTQVSAAGAK
Download sequence
Identical sequences E9PR55
ENSP00000436073 ENSP00000436073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]