SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436176 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000436176
Domain Number - Region: 6-74
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00921
Family Di-heme elbow motif 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436176   Gene: ENSG00000009780   Transcript: ENST00000530324
Sequence length 288
Comment pep:putative chromosome:GRCh38:1:27726028:27759764:1 gene:ENSG00000009780 transcript:ENST00000530324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQ
NVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVD
GKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSQKTLSTSSI
QNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMIL
EKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQVTDSAYFMC
Download sequence
Identical sequences A0A2J8JP23 E9PQL1
ENSP00000436176 ENSP00000436176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]