SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436377 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436377
Domain Number 1 Region: 3-69
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.17e-21
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436377   Gene: ENSG00000167325   Transcript: ENST00000533495
Sequence length 75
Comment pep:known chromosome:GRCh38:11:4116243:4138875:1 gene:ENSG00000167325 transcript:ENST00000533495 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNT
ARYVDQGGNKVCSMN
Download sequence
Identical sequences A0A2J8ITU5 E9PP77
ENSP00000436377 ENSP00000436377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]