SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436405 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000436405
Domain Number - Region: 8-59
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000172
Family Tyrosine-dependent oxidoreductases 0.049
Further Details:      
 
Domain Number - Region: 49-97
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0147
Family Di-heme elbow motif 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436405   Gene: ENSG00000104522   Transcript: ENST00000530474
Sequence length 115
Comment pep:known chromosome:GRCh38:8:143614364:143617511:-1 gene:ENSG00000104522 transcript:ENST00000530474 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTWLAWPGCAWLC
SWKNKHPPISSWKPAPSYQPGPGATLPFDCPSCHSPTQFLHLAPNPGVLVPSRAS
Download sequence
Identical sequences E9PP60
ENSP00000436405 ENSP00000436405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]