SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436429 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436429
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.73e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436429   Gene: ENSG00000131781   Transcript: ENST00000533174
Sequence length 192
Comment pep:known chromosome:GRCh38:1:147212447:147225631:-1 gene:ENSG00000131781 transcript:ENST00000533174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
ATSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EGFTGKRVIIIG
Download sequence
Identical sequences A0A2J8IZS3 E9PP51
ENSP00000436429 ENSP00000436429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]