SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436441 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436441
Domain Number 1 Region: 7-72
Classification Level Classification E-value
Superfamily RING/U-box 3.89e-18
Family Zf-UBP 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436441   Gene: ENSG00000077254   Transcript: ENST00000524778
Sequence length 73
Comment pep:known chromosome:GRCh38:1:77739398:77759820:-1 gene:ENSG00000077254 transcript:ENST00000524778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFRNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPNLWACLENRCSYVGCGESQVDH
STIHSQETKHYLT
Download sequence
Identical sequences ENSP00000436441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]