SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000436642 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000436642
Domain Number 1 Region: 29-89
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000113
Family D-aminoacid oxidase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000436642   Gene: ENSG00000203797   Transcript: ENST00000479373
Sequence length 110
Comment pep:known chromosome:GRCh38:6:110391771:110415562:-1 gene:ENSG00000203797 transcript:ENST00000479373 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVT
IISDKFTPDTTSDVAAGMLIPHTYPVGRYFRALRLKKCHSGLTWFWDFER
Download sequence
Identical sequences A0A2J8PUD7 F2Z2E0
ENSP00000436642 ENSP00000436642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]