SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437030 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437030
Domain Number 1 Region: 106-148
Classification Level Classification E-value
Superfamily TPR-like 0.00000000934
Family Tetratricopeptide repeat (TPR) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437030   Gene: ENSG00000149292   Transcript: ENST00000464224
Sequence length 150
Comment pep:known chromosome:GRCh38:11:113314602:113366386:1 gene:ENSG00000149292 transcript:ENST00000464224 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDADKEKDLQKFLKNVDEISNLIQEMNSDDPVVQQKAVLETEKRLLLMEEDQEEDECRTT
LNKTMISPPQTAMKSAEEINSEAFLASVEKDAKERAKRRRENKVLADALKEKGNEAFAEG
NYETAILRYSEGLEKLKDMKVLYTNRAQQW
Download sequence
Identical sequences E9PP06
ENSP00000437030 ENSP00000460676 ENSP00000437030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]