SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437069 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000437069
Domain Number - Region: 85-107
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0263
Family Tudor domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437069   Gene: ENSG00000176029   Transcript: ENST00000528830
Sequence length 128
Comment pep:known chromosome:GRCh38:11:8927154:8932950:-1 gene:ENSG00000176029 transcript:ENST00000528830 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MESSTGPRMPLLKYCSVATSLKAPGWDGAAPPWDLSFTYPFALQAPWLTGHKPLARHASS
CPCLHVADPAWQGPGWLGRAGDAANTWVLARREADGFYYRAQIKATPEGSAEGSSVATIA
PCLHEPHR
Download sequence
Identical sequences E9PNY9
ENSP00000437069 ENSP00000437069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]