SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437239 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000437239
Domain Number - Region: 36-105
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000916
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437239   Gene: ENSG00000163479   Transcript: ENST00000474377
Sequence length 133
Comment pep:known chromosome:GRCh38:1:156011810:156020914:-1 gene:ENSG00000163479 transcript:ENST00000474377 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELS
DDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPV
VNQPQDSLVLPGS
Download sequence
Identical sequences A0A2J8K536 E9PJ35
ENSP00000435692 ENSP00000437239 ENSP00000435692 ENSP00000437239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]