SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437375 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000437375
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 7.78e-82
Family Integrin A (or I) domain 0.00000031
Further Details:      
 
Domain Number 2 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000235
Family Plexin repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSP00000437375
Domain Number - Region: 377-437
Classification Level Classification E-value
Superfamily Integrin domains 0.000785
Family Integrin domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437375   Gene: ENSG00000139626   Transcript: ENST00000542497
Sequence length 471
Comment pep:known chromosome:GRCh38:12:53191557:53207281:-1 gene:ENSG00000139626 transcript:ENST00000542497 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTGLCRVWGLQDWPTGHQLQYSLCPYQCDPGLGPYLG
Download sequence
Identical sequences F5H6T4
ENSP00000437375 ENSP00000437375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]