SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000437617 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000437617
Domain Number - Region: 78-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000167
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000437617   Gene: ENSG00000130779   Transcript: ENST00000540539
Sequence length 117
Comment pep:putative chromosome:GRCh38:12:122272668:122278472:-1 gene:ENSG00000130779 transcript:ENST00000540539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDI
CDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDETF
Download sequence
Identical sequences A0A1D5RD86 A0A2I2Y7H4 A0A2I3G3M1 A0A2I3M2V2 A0A2I3T7Z3 A0A2J8XJI0 A0A2K5KGI4 A0A2K5MWQ0 A0A2K5VIZ0 A0A2K5YWT1 A0A2K6D463 A0A2K6N5S9 A0A2K6Q022 F5H6H4
ENSP00000437617 ENSP00000437617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]