SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000438248 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438248
Domain Number 1 Region: 162-317
Classification Level Classification E-value
Superfamily EF-hand 5.28e-28
Family Calmodulin-like 0.026
Further Details:      
 
Domain Number 2 Region: 33-145
Classification Level Classification E-value
Superfamily EF-hand 9.67e-18
Family Calmodulin-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438248   Gene: ENSG00000128595   Transcript: ENST00000542996
Sequence length 323
Comment pep:known chromosome:GRCh38:7:128739292:128771477:1 gene:ENSG00000128595 transcript:ENST00000542996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKETDLIIMDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAF
LGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQ
WQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIAT
KEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKT
EREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVD
KYDLFVGSQATDFGEALVRHDEF
Download sequence
Identical sequences A0A2I2YZM2 A0A2I3HNY1 A0A2I3N4Y0 A0A2I3SNH9 A0A2K5JLH0 A0A2K5P6T5 A0A2K5V7J9 A0A2K6AHI0 A0A2K6BGW8 F6ZZ73
gi|314122179|ref|NP_001186601.1| ENSP00000438248 NP_001186601.1.87134 NP_001186601.1.92137 XP_009452281.1.37143 XP_011794946.1.43180 XP_011851297.1.47321 XP_014201298.1.60992 XP_016812271.1.37143 ENSP00000438248 ENSP00000438248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]