SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000438284 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000438284
Domain Number 1 Region: 471-774
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.59e-102
Family PDEase 0.000000602
Further Details:      
 
Domain Number 2 Region: 257-448
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-48
Family GAF domain 0.000029
Further Details:      
 
Domain Number 3 Region: 100-249
Classification Level Classification E-value
Superfamily GAF domain-like 1.53e-19
Family GAF domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000438284   Gene: ENSG00000112541   Transcript: ENST00000539869
Sequence length 789
Comment pep:known chromosome:GRCh38:6:165331050:165662069:-1 gene:ENSG00000112541 transcript:ENST00000539869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRK
NNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKAD
GFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGD
ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWA
SVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALF
QVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCAL
ALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIG
PFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAI
LQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTV
SILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQS
HRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKD
EVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV
AQKAAASED
Download sequence
Identical sequences A0A2I2YX44
NP_001124162.1.87134 NP_001124162.1.92137 ENSP00000438284 ENSGGOP00000003845 ENSP00000438284 ENSGGOP00000003845 gi|194595488|ref|NP_001124162.1| 9606.ENSP00000341187 ENSP00000355847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]