SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439077 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439077
Domain Number 1 Region: 56-231
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-33
Family GAF domain 0.0000000295
Further Details:      
 
Domain Number 2 Region: 218-335
Classification Level Classification E-value
Superfamily GAF domain-like 6.11e-29
Family GAF domain 0.00000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439077   Gene: ENSG00000186642   Transcript: ENST00000475807
Sequence length 336
Comment pep:putative chromosome:GRCh38:11:72584551:72590419:-1 gene:ENSG00000186642 transcript:ENST00000475807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLDRSRGRGRAELGGEVGGLGDPGSRRRARRGAERRLRDPDTEVRRGPLSDRRLALAGE
LYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCL
GQVVEDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGD
LFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQE
IITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQIL
NIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQ
Download sequence
Identical sequences H0YFL1
ENSP00000439077 ENSP00000439077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]