SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439106 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439106
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000309
Family FAD/NAD-linked reductases, N-terminal and central domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439106   Gene: ENSG00000121350   Transcript: ENST00000544970
Sequence length 139
Comment pep:known chromosome:GRCh38:12:21437705:21468770:1 gene:ENSG00000121350 transcript:ENST00000544970 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEAARPPPTAGKFVVVGGGIAGVTCAEQLATHFPSEDILLVTASPVIKAVTNFKQISKIL
EEFDVEEQSSTMLGKRFPNIKVIESGVKQLKSEEHCIVTEDGNQHVYKKLCLCAGAKPKL
ICEGNPYVLGIRDTDSAQV
Download sequence
Identical sequences A0A2J8QRE0 B4DEW4
ENSP00000439106 ENSP00000440192 ENSP00000439106 ENSP00000440192 ENSP00000443912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]