SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439446 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439446
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.94e-40
Family Transglutaminase core 0.0000269
Further Details:      
 
Domain Number 2 Region: 247-346
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.89e-30
Family Transglutaminase, two C-terminal domains 0.0005
Further Details:      
 
Domain Number 3 Region: 135-246
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.72e-30
Family Transglutaminase, two C-terminal domains 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439446   Gene: ENSG00000092295   Transcript: ENST00000544573
Sequence length 375
Comment pep:putative chromosome:GRCh38:14:24249208:24263180:-1 gene:ENSG00000092295 transcript:ENST00000544573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDK
VYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDITYLYKHPEGSDAERKAVETAAA
HGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYT
GVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAK
QHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVG
DIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAPGDGGFFSDAGGD
SHLGETIPMASRGGA
Download sequence
Identical sequences ENSP00000439446 ENSP00000439446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]