SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439697 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439697
Domain Number 1 Region: 210-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-86
Family Protein kinases, catalytic subunit 0.0000292
Further Details:      
 
Weak hits

Sequence:  ENSP00000439697
Domain Number - Region: 521-578
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0172
Family Cytochrome c3-like 0.024
Further Details:      
 
Domain Number - Region: 154-220
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.0589
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439697   Gene: ENSG00000010219   Transcript: ENST00000543431
Sequence length 634
Comment pep:putative chromosome:GRCh38:12:4562204:4613874:1 gene:ENSG00000010219 transcript:ENST00000543431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLLPPPIRTGTKTQMDAKKPRKCDLTPFLVLKARKKQKFTSAKVGSKLSVQIQKPPSNI
KNSRMTQVFHKNTSVTSLPFVDTKGKKNTVSFPHISKKVLLKSSLLYQENQAHNQMPASE
LKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWF
LGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHK
NNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFEL
LGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQAS
VKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFP
GENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMV
LKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWIHQSRNLKPQPRPQTLRKSNSFFPSE
TRKDKVQGCHHSSRKDEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAP
KKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV
Download sequence
Identical sequences A0A0A0MTH5
ENSP00000439697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]