SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439815 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000439815
Domain Number - Region: 22-53
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0288
Family Cytochrome c3-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439815   Gene: ENSG00000093134   Transcript: ENST00000544102
Sequence length 60
Comment pep:known chromosome:GRCh38:6:132726994:132734333:-1 gene:ENSG00000093134 transcript:ENST00000544102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTRESIYPYLEDIPDPGVNWIPCRDPWRKSKKMNEPVSKELCYHCHSECNQYGQWKLYRT
Download sequence
Identical sequences H0YFQ7
ENSP00000439815 ENSP00000439815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]