SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439894 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439894
Domain Number 1 Region: 183-501
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.88e-56
Family Integrin alpha N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 19-214
Classification Level Classification E-value
Superfamily vWA-like 4.01e-45
Family Integrin A (or I) domain 0.0000043
Further Details:      
 
Domain Number 3 Region: 501-648
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-26
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 4 Region: 649-786
Classification Level Classification E-value
Superfamily Integrin domains 5.18e-23
Family Integrin domains 0.0048
Further Details:      
 
Domain Number 5 Region: 821-950
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000994
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439894   Gene: ENSG00000143127   Transcript: ENST00000539363
Sequence length 1024
Comment pep:known chromosome:GRCh38:1:145891214:145910090:-1 gene:ENSG00000143127 transcript:ENST00000539363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPFVTHLFLPLVFLTGCPTYMDVVIVLDGSNSIYPWSEVQTFLRRLVGKLFIDPEQIQ
VGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREGRETKTAQAIMVACTEGFSQSHGG
RPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRYGIAVLGHYLRRQRDPSSFLREIR
TIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGSHAENESSFGLEMSQIGFSTHRLK
DGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEFPPALQNHAAYLGYSVSSMLLRGG
RRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGEQIGSYFGSELCPLDTDRDGTTDV
LLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQPEPPQDARFGFAMGALPDLNQDG
FADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIAAASMPHALSYFGRSVDGRLDLDG
DDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAISVVQRDCRRRGQEAVCLTAALCFQ
VTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGSGQRLSPRRLRLSVGNVTCEQLHFHV
LDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTSIQKLVPFSKDCGPDNECVTDLVLQV
NMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAYNTSLSLIFSRNLHLASLTPQRESPI
KVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSCSSLLSQVFVKLTASSDSLERNGT
LQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTLPVGPGPEFKTTLRVQNLGCYVVS
GLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLTEPPGPPVHPEELQHTNRLNGSNT
QCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFKSLTVVSTFELGTEEGSVLQLTEA
SRWSESLLEVVQTRPILISLWILIGSVLGGLLLLALLVFCLWKLGFFAHKKIPEEEKREE
KLEQ
Download sequence
Identical sequences ENSP00000439894 ENSP00000462836 NP_001289970.1.87134 NP_001289970.1.92137 ENSP00000439894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]