SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000439899 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000439899
Domain Number 1 Region: 401-683
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.68e-92
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000967
Further Details:      
 
Domain Number 2 Region: 224-398
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.22e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00015
Further Details:      
 
Domain Number 3 Region: 685-753
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00000000000000133
Family Anticodon-binding domain of Class II aaRS 0.0029
Further Details:      
 
Domain Number 4 Region: 163-223
Classification Level Classification E-value
Superfamily TGS-like 0.0000000000024
Family TGS domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000439899   Gene: ENSG00000185418   Transcript: ENST00000539112
Sequence length 766
Comment pep:known chromosome:GRCh38:15:101654394:101724410:-1 gene:ENSG00000185418 transcript:ENST00000539112 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAEALAAEAVASRLERQEEDIRWLWSEVERLRDEQLNAPYSCQAEGPCLTREVAQLRAE
NCDLRHRLCSLRLCLAEERSRQATLESAELEAAQEAGAQPPPSQSQDKDMKKKKMKESEA
DSEVKHQPIFIKERLKLFEILKKDHQLLLAIYGKKGDTSNIITVRVADGQTVQGEVWKTT
PYQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHIL
GEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEV
SKEILLEMFKYNKFKCRILNEKVNTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNS
STYWEGNPEMETLQRIYGISFPDNKMMRDWEKFQEEAKNRDHRKIGKEQELFFFHDLSPG
SCFFLPRGAFIYNTLTDFIREEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFEI
EKDTFALKPMNCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQD
DAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKQLQN
SLMDFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSKDGD
DKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVSSEF
FEEGFMADVDLDHSCTLNKKIRNAQLAQYNFILDRFLPSVWQEAWL
Download sequence
Identical sequences B7ZLP8
ENSP00000439899 ENSP00000478827 ENSP00000439899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]