SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440373 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440373
Domain Number 1 Region: 4-176
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.22e-32
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440373   Gene: ENSG00000089094   Transcript: ENST00000539394
Sequence length 180
Comment pep:putative chromosome:GRCh38:12:121532846:121580225:-1 gene:ENSG00000089094 transcript:ENST00000539394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDPDFTVRDVKLLVGSRRLVDVMDVNTQKGTEMSMSQFVRYYETPEAQRDKLYNVISLE
FSHTKLEHLVKRPTVVDLVDWVDNMWPQHLKEKQTEATNAIAEMKYPKVKKYCLMSVKGC
FTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQR
Download sequence
Identical sequences A0A2J8MDE3 A0A2J8XJR1 F5GXC2
ENSP00000440373 ENSP00000440373 ENSP00000475558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]