SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440787 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000440787
Domain Number - Region: 93-127
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00654
Family Ypt/Rab-GAP domain of gyp1p 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440787   Gene: ENSG00000111490   Transcript: ENST00000544190
Sequence length 146
Comment pep:novel chromosome:GRCh38:12:64781194:64830500:1 gene:ENSG00000111490 transcript:ENST00000544190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLRQKDANELKTILRELKYRIGIQSAKLLRHLKQKDRLLHKVQRNCDIVTACLQAVSQ
KRRVDTKLKFTLEPSLGQNGFQQWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAI
DWDKTMRFTFNERSNPDDDSMGIQIV
Download sequence
Identical sequences A0A2J8K0C8 F5GY74
ENSP00000440787 ENSP00000440787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]