SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440837 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440837
Domain Number 1 Region: 32-88
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000000000275
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440837   Gene: ENSG00000135093   Transcript: ENST00000539121
Sequence length 95
Comment pep:putative chromosome:GRCh38:12:109052896:109058096:1 gene:ENSG00000135093 transcript:ENST00000539121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGLVNLGNTCFMNSLLQGL
SACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLL
Download sequence
Identical sequences A0A2J8MZC3 A0A2J8XLK3 F5GXG2
ENSP00000440837 ENSP00000440837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]