SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000440942 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000440942
Domain Number 1 Region: 1-118
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 9.48e-34
Family Asparaginyl hydroxylase-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000440942   Gene: ENSG00000089094   Transcript: ENST00000543852
Sequence length 123
Comment pep:putative chromosome:GRCh38:12:121516347:121537616:-1 gene:ENSG00000089094 transcript:ENST00000543852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVKGCFTDFHIDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDR
VERCQRIELKQGYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTREK
NKL
Download sequence
Identical sequences A0A1D5R1P8 A0A2I3HHI8 A0A2I3M0T0 A0A2I3RG55 A0A2J8XJQ8 A0A2K5CUL2 A0A2K5IKB2 A0A2K5LY55 A0A2K5RE37 A0A2K5U300 A0A2K5XSN4 A0A2K6BQ20 A0A2K6RR27 A0A2K6TH07 F5GXW2
ENSP00000440942 ENSP00000475893 ENSP00000440942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]