SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441062 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441062
Domain Number 1 Region: 45-333
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.83e-20
Family Integrin alpha N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441062   Gene: ENSG00000129636   Transcript: ENST00000544001
Sequence length 464
Comment pep:putative chromosome:GRCh38:16:47155605:47461274:-1 gene:ENSG00000129636 transcript:ENST00000544001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLLTYLPKNYAKSELGAVIFWGQNQTLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFG
ITNESNQPQILLGGNLSWHPALTTTSKMRIPHSHAFIDLTEDFTADLFLTTLNATTSTFQ
FEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGCEDKNCQKSTIYLV
RSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGYPDALVILKN
TSGSNQQAFLLENVPCNNASCEEARRMFKVYWELTDLNQIKDAMVATFFDIYEDGILDIV
VLSKGYTKNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTT
VDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLYVGIPRPSGEKSIRKQEW
TAIIPNSQLIVIPYPHNVPRSSHRCLCFHLGNNWHFTLAGKESR
Download sequence
Identical sequences F5GXC5
ENSP00000441062 NP_001291931.1.87134 NP_001291931.1.92137 ENSP00000441062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]