SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441097 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441097
Domain Number 1 Region: 68-132
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000017
Family Rhomboid-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441097   Gene: ENSG00000158315   Transcript: ENST00000540558
Sequence length 132
Comment pep:putative chromosome:GRCh38:1:38915503:38941799:-1 gene:ENSG00000158315 transcript:ENST00000540558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVHDLEMESMNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRG
TYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFIYSPEKREEA
WRFISYMLVHAG
Download sequence
Identical sequences A0A2J8LYK7 A0A2J8Y6I2
ENSP00000441097 ENSP00000441097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]