SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441322 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441322
Domain Number 1 Region: 12-170
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-31
Family GAF domain 0.0000000719
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441322   Gene: ENSG00000186642   Transcript: ENST00000538299
Sequence length 172
Comment pep:putative chromosome:GRCh38:11:72585426:72590021:-1 gene:ENSG00000186642 transcript:ENST00000538299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSAVTPSPCLSLSQLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQ
VVEDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLF
TDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDV
Download sequence
Identical sequences H0YG13
ENSP00000441322 ENSP00000441322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]