SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441376 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441376
Domain Number 1 Region: 3-60
Classification Level Classification E-value
Superfamily ARM repeat 0.000000288
Family Armadillo repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441376   Gene: ENSG00000184575   Transcript: ENST00000540203
Sequence length 60
Comment pep:known chromosome:GRCh38:12:64405046:64416736:1 gene:ENSG00000184575 transcript:ENST00000540203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVL
Download sequence
Identical sequences A0A2J8K0E5 A0A2J8W0M7 F5GYW6
ENSP00000441376 ENSP00000441376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]