SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000441561 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000441561
Domain Number 1 Region: 8-251
Classification Level Classification E-value
Superfamily vWA-like 2.43e-77
Family Integrin A (or I) domain 0.000000549
Further Details:      
 
Domain Number 2 Region: 252-338
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-20
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 3 Region: 456-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family Integrin beta EGF-like domains 0.0056
Further Details:      
 
Domain Number 4 Region: 412-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Weak hits

Sequence:  ENSP00000441561
Domain Number - Region: 375-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00156
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000441561   Gene: ENSG00000105855   Transcript: ENST00000537992
Sequence length 634
Comment pep:putative chromosome:GRCh38:7:20330702:20410330:1 gene:ENSG00000105855 transcript:ENST00000537992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKT
VSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEG
GFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYV
KSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNN
LVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVT
MKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCD
ENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPY
HHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECT
DPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSE
CFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQ
SVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Download sequence
Identical sequences XP_011513698.1.92137 XP_016867669.1.92137 XP_016867670.1.92137 XP_016867671.1.92137 XP_016867672.1.92137 ENSP00000441561 ENSP00000441561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]