SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000442037 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442037
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000578
Family Canonical RBD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442037   Gene: ENSG00000198000   Transcript: ENST00000536624
Sequence length 145
Comment pep:known chromosome:GRCh38:9:92318669:92325636:-1 gene:ENSG00000198000 transcript:ENST00000536624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVNRETKRLYVGGLSQDISEADLQNQFSRFGEVSDVEIITRKDDQGNPQKVFAYINISV
AEADLKKCMSVLNKTKWKGGTLQIQLAKESFLHRLAQEREAAKAKKEESTTGNANLLEKT
GGVDFHMKAVPGTEVPGHKNWVVSK
Download sequence
Identical sequences A0A2J8IXE1 F5H8B8
ENSP00000442037 ENSP00000442037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]