SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000442256 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442256
Domain Number 1 Region: 574-930
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.3e-110
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 387-569
Classification Level Classification E-value
Superfamily GAF domain-like 5.67e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 218-400
Classification Level Classification E-value
Superfamily GAF domain-like 1.24e-33
Family GAF domain 0.0000000179
Further Details:      
 
Domain Number 4 Region: 38-190
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000196
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442256   Gene: ENSG00000186642   Transcript: ENST00000544570
Sequence length 934
Comment pep:known chromosome:GRCh38:11:72577154:72642460:-1 gene:ENSG00000186642 transcript:ENST00000544570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVLHHILIAVVQFLRRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDISGLQRAV
KEALSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCNGLGFSDL
PGKPLARLVAPLAPDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVA
LRRVQVLQQRGPREAPRAVQNPPEGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQL
KVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEEVSFPLTGCLGQVVEDKKSIQ
LKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLEGDLFTDEDEHVIQ
HCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLSNA
EICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLF
YRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGIS
IAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTP
RSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHF
CYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEGSVME
RHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMAEVG
YDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNRPMEM
MDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGL
PSNNSLDFLDEEYEVPDLDGTRAPINGCCSLDAE
Download sequence
Identical sequences A0A2J8PZQ9
NP_001137311.1.87134 NP_001137311.1.92137 gi|219802706|ref|NP_001137311.1| ENSP00000442256 ENSP00000442256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]