SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000442611 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442611
Domain Number 1 Region: 46-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-23
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442611   Gene: ENSG00000139178   Transcript: ENST00000545337
Sequence length 187
Comment pep:putative chromosome:GRCh38:12:7101605:7109210:-1 gene:ENSG00000139178 transcript:ENST00000545337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRVWGKYLWRSPHSKGCPGAMWWLLLWGVLQACPTRGSVLLAQELPQQLTSPGYPEP
YGKGQESSTDIKAPEGFAVRLVFQDFDLEPSQDCAGDSVTISFVGSDPSQFCGQQGSPLG
RPPGQREFVSSGRSLRLTFRTQPSSENKTAHLHKGFLALYQTVGECPSWGCREGASVPSH
DPGIFKP
Download sequence
Identical sequences F5H7C8
ENSP00000442611 NP_001284572.1.87134 NP_001284572.1.92137 ENSP00000442611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]