SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000442670 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000442670
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000000321
Family L-aminoacid/polyamine oxidase 0.0016
Further Details:      
 
Domain Number 2 Region: 48-112
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000201
Family FAD-linked reductases, N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000442670   Gene: ENSG00000165097   Transcript: ENST00000546309
Sequence length 113
Comment pep:putative chromosome:GRCh38:6:18155329:18222043:1 gene:ENSG00000165097 transcript:ENST00000546309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSF
VKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences Q08EI0
ENSP00000442670 ENSP00000442670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]