SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000443282 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000443282
Domain Number 1 Region: 127-239
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-34
Family Fibronectin type III 0.000000418
Further Details:      
 
Domain Number 2 Region: 29-134
Classification Level Classification E-value
Superfamily Fibronectin type III 3.99e-25
Family Fibronectin type III 0.00000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000443282   Gene: ENSG00000027697   Transcript: ENST00000543628
Sequence length 274
Comment pep:known chromosome:GRCh38:6:137197485:137219370:-1 gene:ENSG00000027697 transcript:ENST00000543628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFT
VEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFA
VCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKGSLWIPVVAALLLFCLAWYSSVFILRKLIH
Download sequence
Identical sequences ENSP00000443282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]